Welcome to LookChem.com Sign In|Join Free

Hebei Nengqian Chemical Import and Export Co., LTD

Assessed Supplier Enterprise Certification

Assessed
Supplier
4th
years
Home>>Products>>High Quality Teriparatide Acetate, Teriparatida, Teriparatidum CAS 99294-94-7 (acetate).....

Product Certification&
Enterprise Certification

More Detail

Hebei Nengqian Chemical Import and Export Co., LTD

Country: China (Mainland)

Business Type:Trading Company

Mr.cui

Tel: 86-139-10575315

Mr.Jacky

Tel: +86 15632961819

Ms.Winnie

Tel: +86 18233902561

Ms.Mandy

Tel: +86 15717685612

Ms.Chris

Tel: +86 16630923639

Ms.Sunny

Tel: +86 18732968538

Ms.Bailey

Tel: +86 18833033983

Ms.Anna

Tel: +86 19831957301

Mobile: +86 19831957301

Tel: 86-139-10575315

Fax: 4001020630

URL: https://www.nengqianchemical.com/

Province/state: Hebei

City: Handan

Street: Congtai District, La Defense North

MaxCard:


qq
    x
  • Ms.Anna
Contact Suppliers

High Quality Teriparatide Acetate, Teriparatida, Teriparatidum CAS 99294-94-7 (acetate).....

CAS NO.99294-94-7

  • FOB Price: USD: 1.00-10.00 /Gram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: L/C,D/A,D/P,T/T,
  • Available Specifications:

    Pharmaceutical intermedia(1-5)GramPharmaceutical intermedia(5-10)Gram

Contact Supplier

Product Details

Keywords

  • Teriparatide, Parathyroid hormone (1-34) (human)
  • Factory direct sale
  • Low-cost sales

Quick Details

  • ProName: High Quality Teriparatide Acetate, Ter...
  • CasNo: 99294-94-7
  • Molecular Formula: C181H291N55O51S2
  • Appearance: white powder
  • Application: Pharmaceutical intermedia
  • DeliveryTime: 7-10 working day
  • PackAge: According yo your request
  • Port: Qingdao\Tianjin
  • ProductionCapacity: 200 Metric Ton/Day
  • Purity: 98%
  • Storage: Keep it in dry, cool and ventilated pl...
  • Transportation: We will pack and ship according to you...
  • LimitNum: 1 Gram
  • Moisture Content: 0.01%
  • Impurity: 0.1%

Superiority

1.Basic information:

Name:Teriparatide Acetate, Teriparatida , Teriparatidum 
Cas No: 52232-67-4(net),99294-94-7(acetate)
Formula: C181H291N55O51S2
Molecular: 4117.71
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Purity:98%
Appearance: white powder
Source: synthetic
Also know as Aventis Brand of Teriparatide,Forteo,hPTH (1-34),Human Parathyroid Hormone (1-34),Lilly Brand of Teriparatide
Parathar,Teriparatide Acetate,Teriparatide Aventis Brand

Teriparatide is a man-made form of parathyroid hormone that exists naturally in the body. Teriparatide increases bone mineral density and bone strength, which may prevent fractures.Teriparatide is used to treat osteoporosis caused by menopause, steroid use, or gonadal failure. teriparatide is for use when you have a high risk of bone fracture due to osteoporosis.Teriparatide may also be used for purposes not listed in this medication guide.

Application
-Treatment of postmenopausal women with osteoporosis at high risk for fracture
-Increase of bone mass in men with primary or hypogonadal osteoporosis at high risk for fracture
-Treatment of men and women with osteoporosis associated with sustained systemic glucocorticoid therapy at high risk for fracture

 

Our advantages: 

1, High quality with competitive price:

1) Standard:BP/USP/EP/Enterprise standard

2) All Purity≥99%

3) We are manufacturer and can provide high quality products with factory price.

 2, Fast and safe delivery

1) Parcel can be sent out in 24 hours after payment.Tracking number available

2) Secure and discreet shipment.Various transportation methods for your choice.

3) Customs pass rate ≥99%

4) We have our own agent/remailer/distributor who can help us ship our products very fast and safe,

and we have stock in there for transferring.

Product Packaging

1) 1kg/bag (1kg net weight, 1.1kg gross weight, packed in an aluminum foil bag)

2) 25kg/drum (25kg net weight, 28kg gross weight; Packed in a cardboard-drum with two plastic-bags inside; Drum Size: 510mm high, 360mm diameter)

 Storage

Stored in a cool and dry well-closed container. Keep away from moisture and strong light/heat.

Delivery

Usually within3-5 working days after full payment.

transport

EMS,DHL, TNT, UPS ,FEDEX, BY AIR, BY SEA

DHL Express, FedEx and EMS for quantity less than 50KG, usually called as DDU service; 

Sea shipping for quantity over 500KG; And air shipping is available for 50KG above;

For high value products, please select air shipping and DHL express for safe;

Our Service:
1. Fast Delivery: We can delivery within 24 hours upon receipt of your payment.
2. Quality can be promised. Hot sell to Worldwide.
3. Payment Terms: T/T,, t/t
4. Free Sample available at any time.
5. Tracking your order at any time. Inform your order's further new situation at any time.
6. Package: Professional packing with professional materials.

Details