Welcome to LookChem.com Sign In|Join Free

Hebei Nengqian Chemical Import and Export Co., LTD

Assessed Supplier Enterprise Certification

Assessed
Supplier
4th
years
Home>>Products>>High Quality Teriparatide Acetate, Teriparatida, Teriparatidum CAS No: 52232-67-4 (net) , 99294-94-7 (acetate)、

Product Certification&
Enterprise Certification

More Detail

Hebei Nengqian Chemical Import and Export Co., LTD

Country: China (Mainland)

Business Type:Trading Company

Mr.Jacky

Tel: +86 15632961819

Mobile: +86 15632961819

Tel: +86 15632961819

Fax: 4001020630

URL: https://www.nengqianchemical.com/

Province/state: Hebei

City: Handan

Street: No.1722, Block C, Yangguang Xinzhuo Plaza, 256 Renmin West Road, Fuxing District, Handan City, Hebei Province

MaxCard:


qq
    x
  • Ms.Anna
Contact Suppliers

High Quality Teriparatide Acetate, Teriparatida, Teriparatidum CAS No: 52232-67-4 (net) , 99294-94-7 (acetate)、

CAS NO.99294-94-7

  • FOB Price: USD: 1.00-10.00 /Gram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: L/C,D/A,D/P,T/T,
  • Available Specifications:

    Pharmaceutical intermedia(1-5)GramPharmaceutical intermedia(5-10)Gram

Contact Supplier

Product Details

Keywords

  • Teriparatide, Parathyroid hormone (1-34) (human)
  • Factory direct sale
  • Low-cost sales

Quick Details

  • ProName: High Quality Teriparatide Acetate, Ter...
  • CasNo: 99294-94-7
  • Molecular Formula: C181H291N55O51S2
  • Appearance: white powder
  • Application: Pharmaceutical intermedia
  • DeliveryTime: 7-10 working day
  • PackAge: According yo your request
  • Port: Qingdao\Tianjin
  • ProductionCapacity: 200 Metric Ton/Day
  • Purity: 98%
  • Storage: Keep it in dry, cool and ventilated pl...
  • Transportation: We will pack and ship according to you...
  • LimitNum: 1 Gram
  • Moisture Content: 0.01%
  • Impurity: 0.1%

Superiority

1.Basic information:

Name:Teriparatide Acetate, Teriparatida , Teriparatidum 
Cas No: 52232-67-4(net),99294-94-7(acetate)
Formula: C181H291N55O51S2
Molecular: 4117.71
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Purity:98%
Appearance: white powder
Source: synthetic
Also know as Aventis Brand of Teriparatide,Forteo,hPTH (1-34),Human Parathyroid Hormone (1-34),Lilly Brand of Teriparatide
Parathar,Teriparatide Acetate,Teriparatide Aventis Brand

Teriparatide is a man-made form of parathyroid hormone that exists naturally in the body. Teriparatide increases bone mineral density and bone strength, which may prevent fractures.Teriparatide is used to treat osteoporosis caused by menopause, steroid use, or gonadal failure. teriparatide is for use when you have a high risk of bone fracture due to osteoporosis.Teriparatide may also be used for purposes not listed in this medication guide.

Application
-Treatment of postmenopausal women with osteoporosis at high risk for fracture
-Increase of bone mass in men with primary or hypogonadal osteoporosis at high risk for fracture
-Treatment of men and women with osteoporosis associated with sustained systemic glucocorticoid therapy at high risk for fracture

 

Our advantages: 

1, High quality with competitive price:

1) Standard:BP/USP/EP/Enterprise standard

2) All Purity≥99%

3) We are manufacturer and can provide high quality products with factory price.

 2, Fast and safe delivery

1) Parcel can be sent out in 24 hours after payment.Tracking number available

2) Secure and discreet shipment.Various transportation methods for your choice.

3) Customs pass rate ≥99%

4) We have our own agent/remailer/distributor who can help us ship our products very fast and safe,

and we have stock in there for transferring.

Product Packaging

1) 1kg/bag (1kg net weight, 1.1kg gross weight, packed in an aluminum foil bag)

2) 25kg/drum (25kg net weight, 28kg gross weight; Packed in a cardboard-drum with two plastic-bags inside; Drum Size: 510mm high, 360mm diameter)

 Storage

Stored in a cool and dry well-closed container. Keep away from moisture and strong light/heat.

Delivery

Usually within3-5 working days after full payment.

transport

EMS,DHL, TNT, UPS ,FEDEX, BY AIR, BY SEA

DHL Express, FedEx and EMS for quantity less than 50KG, usually called as DDU service; 

Sea shipping for quantity over 500KG; And air shipping is available for 50KG above;

For high value products, please select air shipping and DHL express for safe;

Our Service:
1. Fast Delivery: We can delivery within 24 hours upon receipt of your payment.
2. Quality can be promised. Hot sell to Worldwide.
3. Payment Terms: T/T,, t/t
4. Free Sample available at any time.
5. Tracking your order at any time. Inform your order's further new situation at any time.
6. Package: Professional packing with professional materials.

Details

Our company specializes in processing and selling chemical raw materials, chemical products, pharmaceutical intermediates, veterinary medicine intermediates, dye intermediates, pigments, cosmetics raw materials and chemical reagents,  

Our company has a number of sales team, service and information feedback vertical integration of a sound marketing network, products are sold throughout the country and exported to South Asia, Europe, America, Africa and other more than 20 countries and regions.  

Companies adhering to the "pursuit of quality, innovation and development" business philosophy, to serve as a foundation, for the survival by the quality, seek development by science and technology, adhere to quilty comes first,fair price,good sense of customer service and responsibility. in the future hebei Nengqian import and export trade Co.,Ltd will always hold "integrity, innovation" business philosophy, to achieve honesty management, on the way of specialization, internationalization,  Keep moving!  

 

Our advantages: 

1, High quality with competitive price:

1) Standard:BP/USP/EP/Enterprise standard

2) All Purity≥99%

3) We are manufacturer and can provide high quality products with factory price.

 2, Fast and safe delivery

1) Parcel can be sent out in 24 hours after payment.Tracking number available

2) Secure and discreet shipment.Various transportation methods for your choice.

3) Customs pass rate ≥99%

4) We have our own agent/remailer/distributor who can help us ship our products very fast and safe,

and we have stock in there for transferring.

Product Packaging

1) 1kg/bag (1kg net weight, 1.1kg gross weight, packed in an aluminum foil bag)

2) 25kg/drum (25kg net weight, 28kg gross weight; Packed in a cardboard-drum with two plastic-bags inside; Drum Size: 510mm high, 360mm diameter)

 Storage

Stored in a cool and dry well-closed container. Keep away from moisture and strong light/heat.

Delivery

Usually within3-5 working days after full payment.

transport

EMS,DHL, TNT, UPS ,FEDEX, BY AIR, BY SEA

DHL Express, FedEx and EMS for quantity less than 50KG, usually called as DDU service; 

Sea shipping for quantity over 500KG; And air shipping is available for 50KG above;

For high value products, please select air shipping and DHL express for safe;

Our Service:
1. Fast Delivery: We can delivery within 24 hours upon receipt of your payment.
2. Quality can be promised. Hot sell to Worldwide.
3. Payment Terms: T/T,, t/t
4. Free Sample available at any time.
5. Tracking your order at any time. Inform your order's further new situation at any time.
6. Package: Professional packing with professional materials.

FAQ: 
1.Are you a trade company or factory   
We are a  factory with our own trading company.  

2.How do you control the quality   
Our factory is equipped with professional technicians to control quality, out inspectors take sample for testing every 2 hours to ensure the quality of our production. We also accept BV, SGS or any other Third-party inspection.   

3.How long is lead time   
We deliver goods within 3 days for small order, 7-10 days for bulk order.   

4. Where is your factory located  How can I visit the factory   
 Our factory located in HEBEI, China.

5.Can i get some samples  
  Yes, we can supply free sample, but the shipping cost be paid by our customers. 

6.How to start orders or make payments  
  Proforma invoice will be sent first after confirmation of order, enclosed our bank information.Payment by T/T,  

7. How to confirm the Product Quality before placing orders  
  You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. 
8. How long is lead time

We deliver goods within 3 days for small order, 7-10 days for bulk order.

 

9. How do you treat quality complaint

  First of all, our quality control will reduce the quality problem to near zero. If there is a realquality problem caused by us, we will send you free goods for replacement or refund your loss.