Welcome to LookChem.com Sign In|Join Free

Hebei Nengqian Chemical Import and Export Co., LTD

Assessed Supplier Enterprise Certification

Assessed
Supplier
3rd
years
Home>>Products>>47931-85-1 Calcitonin Salmon / Salmon Calcitonin Acetate

Product Certification&
Enterprise Certification

More Detail

Hebei Nengqian Chemical Import and Export Co., LTD

Country: China (Mainland)

Business Type:Trading Company

Mr.cui

Tel: +86 13910575315

Ms.Anna

Tel: 19831957301

Mr.Jacky

Tel: 15632927689

Ms.Winnie

Tel: 18233902561

Ms.Mandy

Tel: 19903295909

Ms.Chris

Tel: +86 16630923639

Ms.Sunny

Tel: 18732968538

Mr.Bailey

Tel: +86 15383190639

Mobile: +86 15632927689

Tel: +86 13910575315

Fax: 0310-8698866

URL: http://hbnq1.com/

Province/state: Hebei

City: Xingtai

Street: hebei

MaxCard:


qq Contact Suppliers

47931-85-1 Calcitonin Salmon / Salmon Calcitonin Acetate

CAS NO.47931-85-1

  • FOB Price: USD: 6.00-10.00 /Kilogram Get Latest Price
  • Min.Order: 1 Kilogram
  • Payment Terms: L/C,D/A,D/P,T/T,MoneyGram,Other
  • Available Specifications:

    Pharmaceutical grade(1-25)KilogramPharmaceutical grade(25-99)Kilogram

Contact Supplier

Product Details

Keywords

  • salmoncalcitonin-(i-32)
  • CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
  • Thyrocalcitonin

Quick Details

  • ProName: 47931-85-1 Calcitonin Salmon / Salmon ...
  • CasNo: 47931-85-1
  • Molecular Formula: C145 H240 N44 O48 S2
  • Appearance: powder
  • Application: It is a polypeptide preparation that ...
  • DeliveryTime: 7-10 working days after deposit
  • PackAge: Inside plastic outside
  • Port: Tianjin or Qingdao
  • ProductionCapacity: 300 Metric Ton/Week
  • Purity: 99%
  • Storage: Stored below 6 ℃, must be protected wi...
  • Transportation: We ship goods via DHL, Fedex, UPS, TNT...
  • LimitNum: 1 Kilogram

Superiority

With our good experience, we offer detailed technical support and advice to assist customers. We communicate closely with customers to establish their quality requirements.

Consistent Quality
Our plant has strict quality control in each manufacturing process. Guaranteed.
Meanwhile all the materials are tested before each shipment in our laboratory to double confirm the quality.

Most competitive pricing
Our company is committed to the production and development of titanium dioxide, we always offer the most competitive pricing to customers to help lower their cost in application.

Shortest delivery time
90% of orders are shipped within 7-10 days after receipt of the prepayment or workable L/C.

Respond in 24 hours to inquiry, feedback or other requirements
Our experienced staff is dedicated to answer all of your inquires, feedback or other requirements in 24 hours.

We welcome you to contact us for more information and look forward to working with yo

Details

Our company specializes in processing and selling chemical raw materials, chemical products, pharmaceutical intermediates, veterinary medicine intermediates, dye intermediates, pigments, cosmetics raw materials and chemical reagents,  

Our company has a number of sales team, service and information feedback vertical integration of a sound marketing network, products are sold throughout the country and exported to South Asia, Europe, America, Africa and other more than 20 countries and regions.  

Companies adhering to the "pursuit of quality, innovation and development" business philosophy, to serve as a foundation, for the survival by the quality, seek development by science and technology, adhere to quilty comes first,fair price,good sense of customer service and responsibility. in the future hebei Nengqian import and export trade Co.,Ltd will always hold "integrity, innovation" business philosophy, to achieve honesty management, on the way of specialization, internationalization,  Keep moving!  

Basic Information

Calcitonin Salmon is a polypeptide hormone secreted by the ultimobranchial gland of salmon. It belongs to the calcitonin-like protein family and can be used to treat Paget's disease of bone, postmenopausal osteoporosis(fragile or brittle bones), or high levels of calcium in the blood (hypercalcemia). It appears to have actions essentially identical to calcitonins of mammalian origin, but its potency per mg is greater and it has a longer duration of action.

Product Name Salmon Calcitonin
Calcitonin
Cas No. 47931-85-1
Sequence c[Cys-Ser-Asn-Leu-Ser-Thr-Cys]-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2
Molecular Formula C145H240N44O48S2
Molar Mass   3431.85g/mol
Purity ≥98%
Impurity ≤0.5% 
Storage Temperature  2-8ºC
Packing Size 1G/Bottle, 10G/Bottle,50G/Bottle or at customers reqirement.

FUNCTION&APPLICATION

Salmon calcitonin, inhibit the activity of osteoclasts,Inhibit bone salt dissolving, prevent bone calcium release;Improve bone mineral density, effectively relieve pain symptoms;Reduce the risk of fractures;Lower blood calcium.

1. Disabled or inability to use early and late postmenopausal osteoporosis and senile osteoporosis in combination with conventional estrogen and calcium preparations.

2. Hypercalcemia secondary to bone metastasis of breast cancer, lung cancer or kidney cancer, myeloma and other malignant tumors.

3 osteoarthritis.

4. Hyperparathyroidism, lack of activity or vitamin D poisoning (including acute or chronic poisoning).

5. Painful neurotrophic or Sudeck's disease.

 

Our advantages: 

1, High quality with competitive price:

1) Standard:BP/USP/EP/Enterprise standard

2) All Purity≥99%

3) We are manufacturer and can provide high quality products with factory price.

 

2, Fast and safe delivery

1) Parcel can be sent out in 24 hours after payment.Tracking number available

2) Secure and discreet shipment.Various transportation methods for your choice.

3) Customs pass rate ≥99%

4) We have our own agent/remailer/distributor who can help us ship our products very fast and safe,

and we have stock in there for transferring.

 

Our Service:
1. Fast Delivery: We can delivery within 24 hours upon receipt of your payment.
2. Quality can be promised. Hot sell to Worldwide.
3. Payment Terms: T/T,, t/t
4. Free Sample available at any time.
5. Tracking your order at any time. Inform your order's further new situation at any time.
6. Package: Professional packing with professional materials.

Packing:  
  1. Inner double plastic bags----25kg/Fiber drum (35*35*45cm, GW: 28kg, NW: 25kg); 

  2. Inner double plastic bags----5kg/Aluminum foil bag (GW: 6.5kg, NW: 5kg). 

  3. Inner double plastic bags----1kg/Aluminum foil bag (GW: 1.5kg, NW: 1kg). 

P.S.: we accept packaging customization. 


  
Delivery:   

  1. Stock products are normally shipping within 3 working days.  

  2. For rush delivery, please contact our sales team for particular arrangement. 



Shipping Details: 
  1. We ship goods via DHL, Fedex, UPS, TNT, China post, NL Post and other couriers, weight from 10g to 1000kg or even bulker. 

  2. Shipping details & shipping documents will be provided and sent by email. 

  3. We keep tracking the shippment until clients well received. 

  4. After years export shipping experience, with professional and experienced cooperated forwarders, we ensure that goods can be delivered in multiple ways safetly and efficiently. 

FAQ: 
1. Are you a trade company or factory   
We are a  factory with our own trading company.  

  1. How do you control the quality   
    Our factory is equipped with professional technicians to control quality, out inspectors take sample for testing every 2 hours to ensure the quality of our production. We also accept BV, SGS or any other Third-party inspection.   
  2.  How long is lead time  
    We deliver goods within 3 days for small order, 7-10 days for bulk order.   
  3.  Where is your factory located How can I visit the factory   
     Our factory located in WEIFANG, China. It is only two hours from QINGDAO.  


6. Can i get some samples 
  Yes, we can supply free sample, but the shipping cost be paid by our customers. 


7. How to start orders or make payments 
  Proforma invoice will be sent first after confirmation of order, enclosed our bank information.Payment by T/T,  


8. How to confirm the Product Quality before placing orders 
  You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. 
  You can send us your product specifications and requests,we will manufacture the products according to your requests. 

9. How long is lead time

We deliver goods within 3 days for small order, 7-10 days for bulk order.

 

10. How do you treat quality complaint

  First of all, our quality control will reduce the quality problem to near zero. If there is a realquality problem caused by us, we will send you free goods for replacement or refund your loss.