Welcome to LookChem.com Sign In|Join Free

Hebei Nengqian Chemical Import and Export Co., LTD

Assessed Supplier Enterprise Certification

Assessed
Supplier
4th
years
Home>>Products>>Sermorelin CAS:86168-78-7

Product Certification&
Enterprise Certification

More Detail

Hebei Nengqian Chemical Import and Export Co., LTD

Country: China (Mainland)

Business Type:Trading Company

Mr.cui

Tel: +86 13910575315

Ms.Anna

Tel: +86 19831957301

Mr.Jacky

Tel: +86 15632927689

Ms.Winnie

Tel: +86 18233902561

Ms.Mandy

Tel: +86 19903295909

Ms.Chris

Tel: +86 16630923639

Ms.Sunny

Tel: +86 18732968538

Mr.Bailey

Tel: +86 15383190639

Mobile: +86 19831957301

Tel: +86 13910575315

Fax: 0310-8698866

URL: http://hbnq1.com/

Province/state: Hebei

City: Handan

Street: Congtai District, La Defense North

MaxCard:


qq Contact Suppliers

Sermorelin CAS:86168-78-7

CAS NO.86168-78-7

  • FOB Price: USD: 5.00-10.00 /Kilogram Get Latest Price
  • Min.Order: 1 Kilogram
  • Payment Terms: T/T,Other
  • Available Specifications:

    99%(1-100)Kilogram99%(100-600)Kilogram99%(600-1000)Kilogram

Contact Supplier

Product Details

Keywords

  • SERMORELIN
  • YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;
  • GROWTH HORMONE RELEASING FACTOR

Quick Details

  • ProName: Sermorelin CAS:86168-78-7
  • CasNo: 86168-78-7
  • Molecular Formula: C149H246N44O42S
  • Appearance: white powder
  • Application: Treat nanosomia and promote children t...
  • DeliveryTime: Within 5-10 working days after the ord...
  • PackAge: fiber can
  • Port: Tianjin/Qingdao
  • ProductionCapacity: 100 Metric Ton/Month
  • Purity: 99
  • Storage: ?20°C
  • Transportation: by sea/air/land
  • LimitNum: 1 Kilogram
  • Grade: Industrial Grade

Superiority

Our advantages:

1. High quality and competitive price:

1) Standard: BP/USP/EP/ enterprise standard

2) All purity ≥99%

3) We are manufacturers and can provide high quality products at factory prices.

2. Fast and safe delivery

1) The package can be sent within 24 hours of payment. A tracking number is available

2) Safe and prudent shipment. Multiple modes of transportation are available for you to choose from.

3) Clearance rate ≥99%

4) We have our own agents/resellers/distributors who can help us ship our products very quickly and safely,

We have stock to transfer.

Our services:
1. Fast delivery: We can deliver within 24 hours after receiving your payment.
2. Quality can be promised. It sells well all over the world.
3. Payment terms: T/T, , t/t
4. Always provide free samples.
5. Keep track of your orders. Keep you informed of further updates on your order.
6. Packaging: Professional packaging, professional materials.

Details

Products Description

Sermorelin (Sermorelin) is a synthetic growth hormone releasing hormone with 29 amino acid polypeptide, which is the amino terminal fragment of endogenous growth hormone releasing hormone (GHRH), and has significant effects on regulating growth. It is suggested that neuropeptides/neurotransmitters, hormones and cytokines are the "common language" of mutual regulation between the nervous system, endocrine system and immune system. In addition to its very fine regulatory mechanism, the immune system is also regulated by the neuro-endocrine-immune network

Sermorelin

CAS: 86168-78-7

Molecular formula C149H246N44O42S

Molecular weight 3357.93

                                                                   

    

Application

Treat nanosomia and promote children to grow tallerks

Package

  1. Inner double plastic bags----25kg/Fiber drum (35*35*45cm, GW: 28kg, NW: 25kg); 

  2. Inner double plastic bags----5kg/Aluminum foil bag (GW: 6.5kg, NW: 5kg). 

  3. Inner double plastic bags----1kg/Aluminum foil bag (GW: 1.5kg, NW: 1kg). 

P.S.: we accept packaging customization. 

Delivery
  1. Stock products are normally shipping within 3 working days.  

  2. For rush delivery, please contact our sales team for particular arrangement. 

Shipping Details: 
  1. We ship goods via DHL, Fedex, UPS, TNT, China post, NL Post and other couriers, weight from 10g to 1000kg or even bulker. 

  2. Shipping details & shipping documents will be provided and sent by email. 

  3. We keep tracking the shippment until clients well received. 

  4. After years export shipping experience, with professional and experienced cooperated forwarders, we ensure that goods can be delivered in multiple ways safetly and efficiently. 

Our company specializes in processing and selling chemical raw materials, chemical products, pharmaceutical intermediates, veterinary medicine intermediates, dye intermediates, pigments, cosmetics raw materials and chemical reagents,  

Our company has a number of sales team, service and information feedback vertical integration of a sound marketing network, products are sold throughout the country and exported to South Asia, Europe, America, Africa and other more than 20 countries and regions.  

Companies adhering to the "pursuit of quality, innovation and development" business philosophy, to serve as a foundation, for the survival by the quality, seek development by science and technology, adhere to quilty comes first,fair price,good sense of customer service and responsibility. in the future hebei Nengqian import and export trade Co.,Ltd will always hold "integrity, innovation" business philosophy, to achieve honesty management, on the way of specialization, internationalization,  Keep moving!  

    

Our advantages:

Hebei Nengqian Chemical Import and Export Co., LTD.. is located in xingtai City, Hebei Province, China. It is a biotechnology enterprise engaged in the research, development, production and sales of animal and plant extracts, cosmetics, pharmaceutical raw materials and intermediates. The company has complete experimental facilities. And advanced testing instruments ensure the stability of product quality from all aspects. The company has a complete sales service system, the products are exported to countries all over the world, and have won a good international reputation with excellent quality and excellent service.
The company has been adhering to the basic principles of "integrity, quality, service, and win-win" to serve customers, constantly strict requirements, set goals, and implement win-win development.

 

   

 

1. All inquiries will be replied within 12 hours.

2. Dedication to quality, supply & service.

3. Strictly on selecting raw materials.

4. Reasonable & competitive price, fast lead time.

5. Sample is available for your evaluation & Formulation development.

6. Faster delivery:Sample order in stock and 3-7 days for bulk production.

7. We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS. Or you also can choose your own shipping forwarder.

8. After-Sale Service:

1) International Authorized Third-Party Test For The Products You Demand.

2) 30 Days Warranty of quality of goods.

 

 

 

FAQ: 
1. Are you a trade company or factory   
We are a  factory with our own trading company.  

  1. How do you control the quality   
    Our factory is equipped with professional technicians to control quality, out inspectors take sample for testing every 2 hours to ensure the quality of our production. We also accept BV, SGS or any other Third-party inspection.   
  2.  How long is lead time  
    We deliver goods within 3 days for small order, 7-10 days for bulk order.   
  3.  Where is your factory located How can I visit the factory   
     Our factory located in WEIFANG, China. It is only two hours from QINGDAO.  


6. Can i get some samples 
  Yes, we can supply free sample, but the shipping cost be paid by our customers. 


7. How to start orders or make payments 
  Proforma invoice will be sent first after confirmation of order, enclosed our bank information.Payment by T/T,  


8. How to confirm the Product Quality before placing orders 
  You can get free samples for some products,you only need to pay the shipping cost or arrange a courier to us and take the samples. 
  You can send us your product specifications and requests,we will manufacture the products according to your requests. 

9. How long is lead time

We deliver goods within 3 days for small order, 7-10 days for bulk order.

 

10. How do you treat quality complaint

  First of all, our quality control will reduce the quality problem to near zero. If there is a realquality problem caused by us, we will send you free goods for replacement or refund your loss.